PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02879.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 949aa    MW: 106887 Da    PI: 5.5858
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02879.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.96.4e-20157203148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEd+ +v++++++G++ W+tIar+++ gR +kqc++rw+++l
  Rsa1.0_02879.1_g00003.1 157 KGPWTKEEDDMIVQLIQKYGPKKWSTIARYLP-GRIGKQCRERWHNHL 203
                              79******************************.*************97 PP

2Myb_DNA-binding422.1e-13209251145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + +WT+eE++ l++a++ +G++ W+   + ++ gR+++ +k++w+
  Rsa1.0_02879.1_g00003.1 209 KEAWTQEEELVLIRAHQVYGNR-WAELTKFLP-GRSDNGIKNHWH 251
                              579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056707.4E-231299IPR008532Domain of unknown function DUF814
SMARTSM007173261153IPR001005SANT/Myb domain
PROSITE profilePS500904.321126151IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.0E-13133167IPR009057Homeodomain-like
PROSITE profilePS5129432.274152207IPR017930Myb domain
SuperFamilySSF466893.33E-31154250IPR009057Homeodomain-like
SMARTSM007174.9E-19156205IPR001005SANT/Myb domain
PfamPF002494.7E-18157203IPR001005SANT/Myb domain
CDDcd001671.46E-16159203No hitNo description
Gene3DG3DSA:1.10.10.606.7E-27168210IPR009057Homeodomain-like
PROSITE profilePS5129417.977208258IPR017930Myb domain
SMARTSM007174.0E-12208256IPR001005SANT/Myb domain
PfamPF002491.8E-11209251IPR001005SANT/Myb domain
CDDcd001672.10E-9211251No hitNo description
Gene3DG3DSA:1.10.10.605.1E-20211258IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MVFYFKARPD AGDYTIFMGL DKFENEELIK YGFPEDVWFH VDKMSSAHVY LRLHKGQGFD  60
NINEGVLEDC AQLVKANSIQ GNKVNNVDVV YTPWSNLKKT ASMDVGQVGF HNSKMVRTIR  120
VEKRVNDIVN RLNKTKDRTD VQCLHRWQKV LNPELVKGPW TKEEDDMIVQ LIQKYGPKKW  180
STIARYLPGR IGKQCRERWH NHLNPAINKE AWTQEEELVL IRAHQVYGNR WAELTKFLPG  240
RSDNGIKNHW HSSVKKKLDS YMSSGLLDQY QAMPLAPFER SSTLQSAFMQ STIDGSGQAE  300
KKIPSMAGCS ISVRDYQNGI INMGQHFHQN EGAVYHSDQY YYPQLEDISV SISEVSYDME  360
DSSQFPDQNV SSQDYQYDFQ ELSEISLEMG QDMSELQMPY TKESKETSLG ASNSTSNIDV  420
ATTTTYTNSE NISSSETECC RILFLDQESE GLSVDQADYQ DPVFSASASD SQKITEATKS  480
PMQSSSSKSI TTAASGKETL RPAPLIISPD KYSKKSSGLI CHPFEAERNS RRNEDGGFIT  540
CANEGPNNSS EECQSYHLND SKKLVPVNDF TSLAEVKPRS LPKHEPIEQH HEDMGASSSL  600
CFPSLDLPVF SSDLLQSKND PLHDYSPLGI RKLLMSTVTC MSPLRLWESP TGKKTLVGAK  660
SILRKRTRDL LTPLSEKRSD KKLEIDIAAS LATDFSRLDV MFDESESRES KSLEKIEQTC  720
LDANVKEKEV ENGESLSGVL SENNNTNKQV LSPSQTVTKV EKGQVSTPRN NMQKTLMATS  780
NKEQHSSASL CLVINSPSRG RNTEGHLVDN ETSNQSFSIF CGTPFKRGLE SPSAWKSPFY  840
VNSLLHSPRF DTDITIEDMD YIFSPVERSY GSRGLMTQRT EHTSAFAAFD AMEVSLSASN  900
YDDARKMKEL DKENNDPLLA ERRVLDFNDC ESPTKVTEAP SPYLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-6013325834159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-6013325834159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324500.0AC232450.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010H02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399657.10.0hypothetical protein EUTSA_v10012583mg
TrEMBLV4KT420.0V4KT42_EUTSA; Uncharacterized protein
STRINGAT5G11510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.20.0myb domain protein 3r-4